Tryptophan rich protein Antibody (4D6)

Name Tryptophan rich protein Antibody (4D6)
Supplier Novus Biologicals
Catalog H00007485-M05
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 4D6
Applications WB ELISA
Species Reactivities Human
Antigen WRB (NP_004618, 29 a.a. - 101 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK
Purity/Format IgG purified
Description Mouse Monoclonal
Gene WRB
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.