GBX2 Antibody (2A4)

Name GBX2 Antibody (2A4)
Supplier Novus Biologicals
Catalog H00002637-M01
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 2A4
Applications WB ELISA ICC/IF
Species Reactivities Human
Antigen GBX2 (NP_001476 114 a.a. - 182 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG
Purity/Format IgG purified
Description Mouse Monoclonal
Gene GBX2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.