beta-Defensin 4/2 Antibody (4C4)

• Supplier: Novus Biologicals
• Catalog: H00001673-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone: 4C4
• Applications: WB ELISA
• Species Reactivities: Human
• Antigen: DEFB4 (NP_004933, 24 a.a. - 64 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: DEFB4A
• Conjugate: Unconjugated