NDUFA8 Antibody (2E10.)

• Supplier: Novus Biologicals
• Catalog: H00004702-M05
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 2E10.
• Applications: WB ELISA IHC-P
• Species Reactivities: Human
• Antigen: NDUFA8 (NP_055037.1, 1 a.a. - 72 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR
• Purity/Format: Protein A purified
• Description: Mouse Monoclonal
• Gene: NDUFA8
• Conjugate: Unconjugated

Product images

Western Blot: NDUFA8 Antibody (2E10) [H00004702-M05] - Analysis of NDUFA8 expression in transfected 293T cell line by NDUFA8 monoclonal antibody (M05), clone 2E10. Lane 1: NDUFA8 transfected lysate (Predicted MW: 20.1 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: NDUFA8 Antibody (2E10) [H00004702-M05] - Analysis of monoclonal antibody to NDUFA8 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml

Sandwich ELISA: NDUFA8 Antibody (2E10) [H00004702-M05] - Detection limit for recombinant GST tagged NDUFA8 is 0.03 ng/ml as a capture antibody.