| Name | GNG11 Antibody (2H5) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002791-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2H5 |
| Applications | WB ELISA PLA |
| Species Reactivities | Human |
| Antigen | GNG11 (NP_004117.1, 1 a.a. - 69 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGS |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | GNG11 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |