SLCO5A1 Antibody

Name SLCO5A1 Antibody
Supplier Novus Biologicals
Catalog NBP1-82498
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM
Purity/Format Immunogen affinity purified
Blocking Peptide SLCO5A1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SLCO5A1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.