SLC34A1 Antibody

Name SLC34A1 Antibody
Supplier Novus Biologicals
Catalog NBP2-13328
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPC GEVLERHEPLPAKLALEEEQKPESRLVPKLRQA
Purity/Format Immunogen affinity purified
Blocking Peptide SLC34A1 Protein
Description Rabbit Polyclonal
Gene SLC34A1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.