TAF6L Antibody
| Name | TAF6L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39083 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TAF6L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TAF6L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: TAF6L Antibody [NBP2-39083] - Staining of human cell line MCF7 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8374_TAF6L-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39083-img0002.jpg)
![Immunohistochemistry: TAF6L Antibody [NBP2-39083] - Staining of human testis shows moderate nuclear positivity in in subset of cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8375_TAF6L-Antibody-Immunohistochemistry-NBP2-39083-img0001.jpg)