U11/U12-35K Antibody
| Name | U11/U12-35K Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39082 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | U11/U12-35K Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SNRNP35 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: U11/U12-35K Antibody [NBP2-39082] - Staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes and moderate nuclear positivity in bile duct cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/286_U11-U12-35K%2520Antibody-Immunohistochemistry-NBP2-39082-img0001.jpg)
Immunohistochemistry: U11/U12-35K Antibody [NBP2-39082] - Staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes and moderate nuclear positivity in bile duct cells.