ASCIZ Antibody
| Name | ASCIZ Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39079 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TFRCTCGCPYASRTALQSHIYRTGHEIPAEHRDPPSKKRKMENCAQNQKLSNKTIESLNNQPIPRPDTQELEASEIKLEPSFEDSCGSNTD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ASCIZ Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ATMIN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ASCIZ Antibody [NBP2-39079] - Staining of human placenta shows moderate nucleolar positivity in decidua cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3656_ASCIZ%2520Antibody-Immunohistochemistry-NBP2-39079-img0001.jpg)
Immunohistochemistry: ASCIZ Antibody [NBP2-39079] - Staining of human placenta shows moderate nucleolar positivity in decidua cells.