Aquaporin-5 Antibody
| Name | Aquaporin-5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39043 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Aquaporin-5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AQP5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: Aquaporin-5 Antibody [NBP2-39043] - Staining of human cell line SiHa shows localization to plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26747_Aquaporin-5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39043-img0002.jpg)
![Immunohistochemistry: Aquaporin-5 Antibody [NBP2-39043] - Staining of human salivary gland shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26748_Aquaporin-5-Antibody-Immunohistochemistry-NBP2-39043-img0001.jpg)