Polypeptide GalNac Transferase 7/GALNT7 Antibody
| Name | Polypeptide GalNac Transferase 7/GALNT7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39054 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Polypeptide GalNac Transferase 7/GALNT7 Protein |
| Description | Rabbit Polyclonal |
| Gene | GALNT7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39054] - Staining of human cell line HeLa shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9227_Polypeptide-GalNac-Transferase-7-GALNT7-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39054-img0002.jpg)
Immunocytochemistry/Immunofluorescence: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39054] - Staining of human cell line HeLa shows localization to the Golgi apparatus.
![Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39054] - Staining of human stomach shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9228_Polypeptide%2520GalNac%2520Transferase%25207-GALNT7%2520Antibody-Immunohistochemistry-Paraffin-NBP2-39054-img0003.jpg)
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39054] - Staining of human stomach shows strong granular cytoplasmic positivity in glandular cells.