ADPRHL1 Antibody
| Name | ADPRHL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39073 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ALFVSFAAQGKPLVQWGRDMLRAVPLAEEYCRKTIRHTAEYQEHWFYFEAKWQFYLEERKISKDSENKAIFPDNYDAEEREKTYRKWSSEGR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ADPRHL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADPRHL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ADPRHL1 Antibody [NBP2-39073] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Skeletal muscle tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6717_ADPRHL1-Antibody-Western-Blot-NBP2-39073-img0002.jpg)
Western Blot: ADPRHL1 Antibody [NBP2-39073] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Skeletal muscle tissue
![Immunocytochemistry/Immunofluorescence: ADPRHL1 Antibody [NBP2-39073] - Staining of human cell line MCF7 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6718_ADPRHL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39073-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ADPRHL1 Antibody [NBP2-39073] - Staining of human cell line MCF7 shows localization to nucleoplasm.
![Immunohistochemistry: ADPRHL1 Antibody [NBP2-39073] - Staining of human hippocampus shows moderate nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6719_ADPRHL1-Antibody-Immunohistochemistry-NBP2-39073-img0001.jpg)
Immunohistochemistry: ADPRHL1 Antibody [NBP2-39073] - Staining of human hippocampus shows moderate nuclear positivity in neuronal cells.