HBQ1 Antibody
| Name | HBQ1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38960 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RHYPGDFSPALQASLDKFLSHVISALVSEYR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HBQ1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HBQ1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HBQ1 Antibody [NBP2-38960] - Staining of human cell line U-2 OS shows localization to lipid droplets.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10323_HBQ1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38960-img0002.jpg)
Immunocytochemistry/Immunofluorescence: HBQ1 Antibody [NBP2-38960] - Staining of human cell line U-2 OS shows localization to lipid droplets.
![Immunohistochemistry: HBQ1 Antibody [NBP2-38960] - Staining of human bone marrow shows moderate cytoplasmic and nuclear positivity in a subset of hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10324_HBQ1-Antibody-Immunohistochemistry-NBP2-38960-img0001.jpg)
Immunohistochemistry: HBQ1 Antibody [NBP2-38960] - Staining of human bone marrow shows moderate cytoplasmic and nuclear positivity in a subset of hematopoietic cells.