PBOV1 Antibody

Name PBOV1 Antibody
Supplier Novus Biologicals
Catalog NBP2-38982
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDY
Purity/Format Immunogen affinity purified
Blocking Peptide PBOV1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PBOV1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.