OR5T2 Antibody
| Name | OR5T2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38966 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MSYSIYKSTVNIPLSHGVVHSFCHNMNCNFMHIFKFVLDFNMKNVTEVTL |
| Description | Rabbit Polyclonal |
| Gene | OR5T2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: OR5T2 Antibody [NBP2-38966] - Staining of human esophagus shows moderate membranous positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23272_OR5T2%2520Antibody-Immunohistochemistry-NBP2-38966-img0001.jpg)
Immunohistochemistry: OR5T2 Antibody [NBP2-38966] - Staining of human esophagus shows moderate membranous positivity in squamous epithelial cells.