PPM1H Antibody
| Name | PPM1H Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38859 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PPM1H Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPM1H |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: PPM1H Antibody [NBP2-38859] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9499_PPM1H-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38859-img0002.jpg)
![Immunohistochemistry: PPM1H Antibody [NBP2-38859] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9500_PPM1H-Antibody-Immunohistochemistry-NBP2-38859-img0001.jpg)