PLA2G4F Antibody
| Name | PLA2G4F Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38800 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LVNRTFRTHLAPGVERQTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDRHQARERA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PLA2G4F Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PLA2G4F |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: PLA2G4F Antibody [NBP2-38800] - Staining of human small intestine shows moderate luminal membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2882_PLA2G4F%2520Antibody-Immunohistochemistry-NBP2-38800-img0001.jpg)
Immunohistochemistry: PLA2G4F Antibody [NBP2-38800] - Staining of human small intestine shows moderate luminal membranous positivity in glandular cells.