CHES1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-38866
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: IHC
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEELT
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: CHES1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: FOXN3

Product images

Immunohistochemistry: CHES1 Antibody [NBP2-38866] - Staining of human lymph node shows distinct cytoplasmic positivity in fractions of cells.