PET112L Antibody
| Name | PET112L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38843 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQISSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPVLNR |
| Description | Rabbit Polyclonal |
| Gene | GATB |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: PET112L Antibody [NBP2-38843] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23318_PET112L%2520Antibody-Immunohistochemistry-NBP2-38843-img0001.jpg)
Immunohistochemistry: PET112L Antibody [NBP2-38843] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of hematopoietic cells.