TRAM2 Antibody

Name TRAM2 Antibody
Supplier Novus Biologicals
Catalog NBP2-38836
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: AFLFILPQYNISVPTADSETVHYHYGPKDL
Purity/Format Immunogen affinity purified
Blocking Peptide TRAM2 Protein
Description Rabbit Polyclonal
Gene TRAM2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.