ALDH8A1 Antibody
| Name | ALDH8A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38753 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ALDH8A1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ALDH8A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ALDH8A1 Antibody [NBP2-38753] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14599_ALDH8A1%2520Antibody-Western%2520Blot-NBP2-38753-img0003.jpg)
Western Blot: ALDH8A1 Antibody [NBP2-38753] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
![Immunocytochemistry/Immunofluorescence: ALDH8A1 Antibody [NBP2-38753] - Staining of human cell line Hep G2 shows localization to centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14600_ALDH8A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38753-img0002.jpg)
Immunocytochemistry/Immunofluorescence: ALDH8A1 Antibody [NBP2-38753] - Staining of human cell line Hep G2 shows localization to centrosome.
![Immunohistochemistry: ALDH8A1 Antibody [NBP2-38753] - Staining of human liver shows strong cytoplasmic and nuclear membrane positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14601_ALDH8A1-Antibody-Immunohistochemistry-NBP2-38753-img0001.jpg)
Immunohistochemistry: ALDH8A1 Antibody [NBP2-38753] - Staining of human liver shows strong cytoplasmic and nuclear membrane positivity in hepatocytes.