FAM123C Antibody
| Name | FAM123C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38719 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SDFTRFWDSVNRSVRQQQRALLGPWLSGPQGTDRDQPRLDTAGLAELPLCPCRDPRSGSKASSIDTGTPKSEQPESVSTS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM123C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AMER3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM123C Antibody [NBP2-38719] - Staining of human cell line CACO-2 shows localization to nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8456_FAM123C-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38719-img0002.jpg)
Immunocytochemistry/Immunofluorescence: FAM123C Antibody [NBP2-38719] - Staining of human cell line CACO-2 shows localization to nuclear bodies.
![Immunohistochemistry: FAM123C Antibody [NBP2-38719] - Staining of human tonsil shows a moderate cytoplasmic positivity in a subset of non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8457_FAM123C-Antibody-Immunohistochemistry-NBP2-38719-img0001.jpg)
Immunohistochemistry: FAM123C Antibody [NBP2-38719] - Staining of human tonsil shows a moderate cytoplasmic positivity in a subset of non-germinal center cells.