BCAS1 Antibody
| Name | BCAS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38736 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAGKDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BCAS1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BCAS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: BCAS1 Antibody [NBP2-38736] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9241_BCAS1%2520Antibody-Western%2520Blot-NBP2-38736-img0002.jpg)
![Immunohistochemistry: BCAS1 Antibody [NBP2-38736] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9242_BCAS1-Antibody-Immunohistochemistry-NBP2-38736-img0001.jpg)