DELGEF Antibody
| Name | DELGEF Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38366 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: WTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATEVSCGSEHNLAIIGGVCYSWGWNEH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DELGEF Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SERGEF |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: DELGEF Antibody [NBP2-38366] - Staining of human cell line HEK 293 shows localization to cytosol & aggresome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10335_DELGEF-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38366-img0002.jpg)
![Immunohistochemistry-Paraffin: DELGEF Antibody [NBP2-38366] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10336_DELGEF%2520Antibody-Immunohistochemistry-Paraffin-NBP2-38366-img0003.jpg)