Reticulon 2 Antibody

Name Reticulon 2 Antibody
Supplier Novus Biologicals
Catalog NBP2-38225
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: TAMEWLKTSLLLAVYKTVPILELSPPLWTAIGWVQRGPTPPTPVLRVLLKWAKSPRSSGVPSLSLGADMGSKV
Purity/Format Immunogen affinity purified
Blocking Peptide Reticulon 2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene RTN2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.