ZSCAN23 Antibody
| Name | ZSCAN23 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38274 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EVCPVQEIDGKAGTWNVELAPKREISQEVKSLIQVLGKQNGNITQIPEYGDTCDREGRLEKQRVS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZSCAN23 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZSCAN23 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ZSCAN23 Antibody [NBP2-38274] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/142_ZSCAN23%2520Antibody-Immunohistochemistry-Paraffin-NBP2-38274-img0002.jpg)
Immunohistochemistry-Paraffin: ZSCAN23 Antibody [NBP2-38274] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.