RNF186 Antibody
| Name | RNF186 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38256 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RNF186 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RNF186 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: RNF186 Antibody [NBP2-38256] - Staining of human rectum shows strong positivity in goblet cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/358_RNF186%2520Antibody-Immunohistochemistry-NBP2-38256-img0001.jpg)
Immunohistochemistry: RNF186 Antibody [NBP2-38256] - Staining of human rectum shows strong positivity in goblet cells.