WARP/VWA1 Antibody
| Name | WARP/VWA1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38250 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QLFAEASGARPGVPKVLVWVTDGGSSDPVGPPMQELKDLGVTVFIVSTGRGNFLELSAAASAPAEKHLHFVDVDDLHIIVQELRGSILDAM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | WARP/VWA1 Protein |
| Description | Rabbit Polyclonal |
| Gene | VWA1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: WARP/VWA1 Antibody [NBP2-38250] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23442_WARP-VWA1%2520Antibody-Immunohistochemistry-NBP2-38250-img0001.jpg)
Immunohistochemistry: WARP/VWA1 Antibody [NBP2-38250] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in glandular cells.