ITPKB Antibody
| Name | ITPKB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38157 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AFVRMEKGIPASPRCGSPTAMEIDKRGSPTPGTRSCLAPSLGLFGASLTMATEVAARVTSTGPHRPQDLALTEPSGR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ITPKB Protein |
| Description | Rabbit Polyclonal |
| Gene | ITPKB |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ITPKB Antibody [NBP2-38157] - Staining of human kidney shows moderate cytoplasmic, nuclear and membranous positivity in subset of cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23459_ITPKB%2520Antibody-Immunohistochemistry-NBP2-38157-img0001.jpg)
Immunohistochemistry: ITPKB Antibody [NBP2-38157] - Staining of human kidney shows moderate cytoplasmic, nuclear and membranous positivity in subset of cells in tubules.