SAMD5 Antibody

Name SAMD5 Antibody
Supplier Novus Biologicals
Catalog NBP2-38110
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRIL
Purity/Format Immunogen affinity purified
Blocking Peptide SAMD5 Protein
Description Rabbit Polyclonal
Gene SAMD5
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.