alpha-1A Adrenergic R/ADRA1A Antibody
| Name | alpha-1A Adrenergic R/ADRA1A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38145 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | alpha-1A Adrenergic R/ADRA1A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADRA1A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: alpha-1A Adrenergic R/ADRA1A Antibody [NBP2-38145] - Staining of human lateral ventricle shows strong cytoplasmic positivity in astrocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/323_alpha-1A%2520Adrenergic%2520R-ADRA1A%2520Antibody-Immunohistochemistry-NBP2-38145-img0001.jpg)
Immunohistochemistry: alpha-1A Adrenergic R/ADRA1A Antibody [NBP2-38145] - Staining of human lateral ventricle shows strong cytoplasmic positivity in astrocytes.