Staufen Antibody
| Name | Staufen Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38615 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Staufen Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | STAU1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Staufen Antibody [NBP2-38615] - Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9491_Staufen%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38615-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Staufen Antibody [NBP2-38615] - Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol.
![Immunohistochemistry-Paraffin: Staufen Antibody [NBP2-38615] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9492_Staufen-Antibody-Immunohistochemistry-Paraffin-NBP2-38615-img0003.jpg)
Immunohistochemistry-Paraffin: Staufen Antibody [NBP2-38615] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.