Dynein heavy chain Antibody
| Name | Dynein heavy chain Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38671 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Dynein heavy chain Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DNAH9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Dynein heavy chain Antibody [NBP2-38671] - Staining of human fallopian tube shows strong ciliary positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20424_Dynein%2520heavy%2520chain%2520Antibody-Immunohistochemistry-NBP2-38671-img0001.jpg)
Immunohistochemistry: Dynein heavy chain Antibody [NBP2-38671] - Staining of human fallopian tube shows strong ciliary positivity in glandular cells.