TYW1 Antibody
| Name | TYW1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38503 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDSLKKIDRPLFKDFWQQFLDSLKALAVKQQRTVYR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TYW1 Protein |
| Description | Rabbit Polyclonal |
| Gene | TYW1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: TYW1 Antibody [NBP2-38503] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23540_TYW1%2520Antibody-Immunohistochemistry-NBP2-38503-img0001.jpg)
Immunohistochemistry: TYW1 Antibody [NBP2-38503] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.