RTN1 Antibody
| Name | RTN1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38527 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SITPPSSGTEPSAAESQGKGSISEDELITAIKEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RTN1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RTN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: RTN1 Antibody [NBP2-38527] - Staining of human cell line SiHa shows localization to endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10636_RTN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38527-img0002.jpg)
![Immunohistochemistry: RTN1 Antibody [NBP2-38527] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10637_RTN1-Antibody-Immunohistochemistry-NBP2-38527-img0001.jpg)