CAPZA3 Antibody
| Name | CAPZA3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38425 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CAPZA3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CAPZA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CAPZA3 Antibody [NBP2-38425] - Staining of human testis shows moderate cytoplasmic positivity in subset of cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4793_CAPZA3%2520Antibody-Immunohistochemistry-NBP2-38425-img0001.jpg)
Immunohistochemistry: CAPZA3 Antibody [NBP2-38425] - Staining of human testis shows moderate cytoplasmic positivity in subset of cells in seminiferous ducts.