GO Protein alpha Antibody
| Name | GO Protein alpha Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38477 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GO Protein alpha Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GNAO1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: GO Protein alpha Antibody [NBP2-38477] - Staining of human cerebellum shows distinct positivity in neuropil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23612_GO%2520Protein%2520alpha%2520Antibody-Immunohistochemistry-NBP2-38477-img0001.jpg)
Immunohistochemistry: GO Protein alpha Antibody [NBP2-38477] - Staining of human cerebellum shows distinct positivity in neuropil.