BTF3L4 Antibody
| Name | BTF3L4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38097 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BTF3L4 Protein |
| Description | Rabbit Polyclonal |
| Gene | BTF3L4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: BTF3L4 Antibody [NBP2-38097] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line NTERA-2](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6842_BTF3L4%2520Antibody-Western%2520Blot-NBP2-38097-img0002.jpg)
![Immunohistochemistry: BTF3L4 Antibody [NBP2-38097] - Staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6843_BTF3L4-Antibody-Immunohistochemistry-NBP2-38097-img0001.jpg)