FAM177B Antibody
| Name | FAM177B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38015 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVREYGTIQQDVTEAIPQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM177B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM177B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: FAM177B Antibody [NBP2-38015] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20337_FAM177B%2520Antibody-Immunohistochemistry-NBP2-38015-img0001.jpg)
Immunohistochemistry: FAM177B Antibody [NBP2-38015] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.