ZNF383 Antibody
| Name | ZNF383 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38034 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQEIF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF383 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF383 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZNF383 Antibody [NBP2-38034] - Immunofluorescent staining of human cell line RT4 shows localization to nucleus & nuclear membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11199_ZNF383%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38034-img0002.jpg)
Immunocytochemistry/Immunofluorescence: ZNF383 Antibody [NBP2-38034] - Immunofluorescent staining of human cell line RT4 shows localization to nucleus & nuclear membrane.
![Immunohistochemistry: ZNF383 Antibody [NBP2-38034] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11200_ZNF383-Antibody-Immunohistochemistry-NBP2-38034-img0001.jpg)
Immunohistochemistry: ZNF383 Antibody [NBP2-38034] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.