R3HDM4 Antibody
| Name | R3HDM4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37924 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RLLRFFSVSPQAVYTAMLDNSFERLLLHAVCQYMDLISASADLEGKRQMKVSNRHLDFLPPGLLLSAYLEQHS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | R3HDM4 Protein |
| Description | Rabbit Polyclonal |
| Gene | R3HDM4 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: R3HDM4 Antibody [NBP2-37924] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23703_R3HDM4%2520Antibody-Immunohistochemistry-NBP2-37924-img0001.jpg)
Immunohistochemistry: R3HDM4 Antibody [NBP2-37924] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.