GASP-2/WFIKKN Antibody
| Name | GASP-2/WFIKKN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37904 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PNMTAGDGPLVIMGEVRDGVAVLDAGSYVRAASEKRVKKILELLEKQACELLNRFQD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GASP-2/WFIKKN Protein |
| Description | Rabbit Polyclonal |
| Gene | WFIKKN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: GASP-2/WFIKKN Antibody [NBP2-37904] - Staining of human kidney shows moderate cytoplasmic positivity in cell in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4473_GASP-2-WFIKKN%2520Antibody-Immunohistochemistry-NBP2-37904-img0001.jpg)
Immunohistochemistry: GASP-2/WFIKKN Antibody [NBP2-37904] - Staining of human kidney shows moderate cytoplasmic positivity in cell in tubules.