KIF21A Antibody
| Name | KIF21A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37969 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KIF21A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KIF21A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: KIF21A Antibody [NBP2-37969] - Staining of human cell line SH-SY5Y shows localization to plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6483_KIF21A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37969-img0002.jpg)
![Immunohistochemistry: KIF21A Antibody [NBP2-37969] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6484_KIF21A-Antibody-Immunohistochemistry-NBP2-37969-img0001.jpg)