BHLHA9 Antibody
| Name | BHLHA9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37997 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BHLHA9 Protein |
| Description | Rabbit Polyclonal |
| Gene | BHLHA9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: BHLHA9 Antibody [NBP2-37997] - Staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/298_BHLHA9%2520Antibody-Immunohistochemistry-NBP2-37997-img0001.jpg)
Immunohistochemistry: BHLHA9 Antibody [NBP2-37997] - Staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.