C4orf32 Antibody
| Name | C4orf32 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37990 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NHTGEPVGDDYKKMGTLFGELNKNLINMGFTRM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C4orf32 Protein |
| Description | Rabbit Polyclonal |
| Gene | C4orf32 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: C4orf32 Antibody [NBP2-37990] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23745_C4orf32%2520Antibody-Immunohistochemistry-NBP2-37990-img0001.jpg)
Immunohistochemistry: C4orf32 Antibody [NBP2-37990] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.