PADI1 Antibody
| Name | PADI1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37761 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN. |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PADI1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PADI1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: PADI1 Antibody [NBP2-37761] - Staining of human cell line HaCaT shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6289_PADI1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37761-img0002.jpg)
![Immunohistochemistry: PADI1 Antibody [NBP2-37761] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6290_PADI1-Antibody-Immunohistochemistry-NBP2-37761-img0001.jpg)