STK22C Antibody
| Name | STK22C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80727 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KGDVWSMGVVLYVMLCASLPFDDTDIPKMLWQQQKGVSFPTHLSISADCQDLLKRLLEPDMILRPSIEEVSWHPWLAS |
| Description | Rabbit Polyclonal |
| Gene | TSSK3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: STK22C Antibody [NBP1-80727] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23788_STK22C-Antibody-Immunohistochemistry-NBP1-80727-img0003.jpg)
Immunohistochemistry: STK22C Antibody [NBP1-80727] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.