SSTK-IP Antibody
| Name | SSTK-IP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80718 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLECMYANLQLQTQLAQQQMAVLEHLQASVTQLAPGRGSNNSSLPALSPNPLLNHLPQFSK |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TSACC |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SSTK-IP Antibody [NBP1-80718] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23789_SSTK-IP-Antibody-Immunohistochemistry-NBP1-80718-img0004.jpg)
Immunohistochemistry: SSTK-IP Antibody [NBP1-80718] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.