GLB1L Antibody
| Name | GLB1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81235 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GRYWTKQGPQQTLYVPRFLLFPRGALNKITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GLB1L Protein |
| Description | Rabbit Polyclonal |
| Gene | GLB1L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: GLB1L Antibody [NBP1-81235] - Staining of human testis shows strong nuclear and cytoplasmic positivity in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20476_GLB1L%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81235-img0004.jpg)
Immunocytochemistry/Immunofluorescence: GLB1L Antibody [NBP1-81235] - Staining of human testis shows strong nuclear and cytoplasmic positivity in seminiferous ducts.